PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G36080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 1657aa    MW: 184468 Da    PI: 8.709
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G36080.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.23.6e-19152015723385
                       -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
               B3   33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85  
                       ++ l +ed +g++W+++++ +++s++yvltkGW++Fv+++gL++gD++vF+ +
  ONIVA02G36080.1 1520 GVLLNFEDGEGKVWRFRYSCWNSSQSYVLTKGWSRFVREKGLRAGDTIVFSGS 1572
                       56799*********************************************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF032543.6E-180265728IPR004938Xyloglucan fucosyltransferase
PfamPF032542.6E-1929351387IPR004938Xyloglucan fucosyltransferase
SMARTSM010190.005614441587IPR003340B3 DNA binding domain
SuperFamilySSF1019361.7E-1615171574IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.1E-2015181588IPR015300DNA-binding pseudobarrel domain
PfamPF023622.3E-1615191572IPR003340B3 DNA binding domain
PROSITE profilePS5086311.51915231587IPR003340B3 DNA binding domain
CDDcd100171.94E-1415251569No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0036065Biological Processfucosylation
GO:0042546Biological Processcell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0008107Molecular Functiongalactoside 2-alpha-L-fucosyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1657 aa     Download sequence    Send to blast
MYYVRGAGGS WEKAESEACV HESARRRGVP MDEKRAARTP RAGARNAVNG GESGCCSEKA  60
ARWGWRAPVE VAVVGFVATL TLLVLLYGGT GSLLSFTSPR TEFVRKLAAD KRGRRGWAAA  120
GGGVARGGGG AGDGRDGEDK CRPAMEAAEA GSMAWRTAVR GRQRSARTTV RPTVAGAIGA  180
ERRGQAGGGG EAGTMGMGGG LVSTFSRMLR SNRMLAGLRL RCTSDSGLVW WRNSSAVVIS  240
AEILNRWLHG IDGRRLQLHR AAAAASPSHG APEDTPESST RHDDDRLLGG LLSQAFDEHS  300
CRSRYTSSLY RRRSPFRPST YLVERLRRYE ARHKRCGPGS ALFQEAVEHL RSGRNAARSE  360
CQYVVWTPFN GLGNRMLALA STFLYALLTD RVLLVHAPPE FDGLFCEPFP GSSWTLPADF  420
LITDFDGVFT MWSPTSYKNM RQAGTISNAT AEQSLPAYVF LDLIQSFTDA AFCDDDQQVL  480
AKFNWMVIKS DVYFAAMLFL MPAYERELTQ LFPEKEAVFH HLARYLFHPS NDVWGIVHRF  540
YEAYLARADE LVGLQVRVFP EMPIPFDNMY EQIIRCSEQE GLLPKLGQTV VVTAANGSSV  600
VAPSTKLTSI LVTSLFPDYY DRIRGVYHAR PTETGEYVAV HQPSHEREQR TEARGHNQRA  660
LAEIYLLSFC DRVVTSAVST FGYIAHGLAG VRPWVLLRPP SPVARAEPAC VRSETVEPCL  720
QALPRRMCGA AEGSDIGALV PHIRHCEDVQ KGVKLGWPPA GRAAENEARR WGRLRRASAR  780
AALVLCSLTM IPVVVVLHRC AVSSSWPDRV FEAKHIAGAG EQALPIETHM ERSGGGGADG  840
DEERLPLHHG FETERAAPWA AAESKPPPPP RGRFGRASVR AALAVCFLAI PAVLLLQRWQ  900
AGSSPEWLFE IEPPADGDRD MQDDLPDDLT ASQYIGYDKF LGGLLQEGFD EVSCRSRYQF  960
ARYHKNFTRI PSSYLLERLR RQEALQKKCG PGTKSYKQAV KLLRSSQGVN MTTDCNYLFL  1020
TVHAGLGNRM LEIASAFLYA LLTNRILLLD RYQEIGDLFC EPFPGTSWLM PSDFPLNYGE  1080
FTQSSPESYG NMQQNKVVGD NTDRSLAGFR PPYVFLYLDG NYEFHDKLFF CEDDQQFLQD  1140
VPWLIMRTDM YFIPSLFLIP SYQDELSRLF PEKDAVFHHL ARYLFHPTNS IWYSVKGYYR  1200
SYLAKANKTV GIQIRIFEKE GILQKNGRFP YVLEQILSCA QNEKLLPEIS MKDEAEAPTA  1260
TKNNQTIAVL TTSLSSWYSD QIQKKYSEHP TVDGTRVEVY QPSHEEYQRS KNKKHNMKAL  1320
AEIYLLSMTD VLITSGFSTF GYAAQGLSGL TPWIMFRSEN HAMPDPPCRR AMSIEPCFHQ  1380
APFYDCKAKR NADLGKMVPF VRHCEDVSWG LKVVLAAKSQ MGVWEAELVG KGSEIGLAIT  1440
LLPLLAVFLL GENVRLAVND FAKAHQPAGT SDTNTSAFRR RQAQPPAGAQ AARGEALPAA  1500
ADELRRLRHR RRGHLQLCKG VLLNFEDGEG KVWRFRYSCW NSSQSYVLTK GWSRFVREKG  1560
LRAGDTIVFS GSAYGPDKLL FIDCKKNNTA AATGDEKPIT SGEATRVVRL FGMDITGGGG  1620
DCRKRERAVE MGQEAFLMKR QCVHSTPHYT VRSAKAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A1e-241498158520115DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626866.10.0PREDICTED: probable fucosyltransferase 8 isoform X2
TrEMBLA0A0E0GDC30.0A0A0E0GDC3_ORYNI; Uncharacterized protein
STRINGBGIOSGA009101-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13260.15e-27related to ABI3/VP1 1